DPCstruct | MC56965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 197 ± 21 aa |
| Standard deviation of domain lengths | 20.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7DG61 | 1-203 | MNKIVALCVLALTVGMIGDCCRASSSASSSYEADYQRFLKVKLVYCPKKESDVGKIVLPIKELRNPLEGTFDLSGYDDTGQYLSIAT… |
| A0A1M3H7Z0 | 96-278 | TPKNENIYQQFLNGILIYRPDPKSDKGKIELPIAALTNPLESTFDLSSCGDTGKHLSIATGYSKGYNPANSTKVEVWLTPRFLVDQN… |
| A0A3C1CB19 | 231-447 | None |
| A0A4Q7DHA7 | 108-341 | None |
| A0A7W1M8D0 | 107-268 | None |
| A0A3D4YDK3 | 138-334 | None |
| A0A3D1MW59 | 210-405 | None |
| A0A077ASQ9 | 580-762 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.