DPCstruct | MC56960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 180 ± 30 aa |
| Standard deviation of domain lengths | 30.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438JWV9 | 14-195 | MYTLNEDDDMKAKFAAMTRRLEELELKKMHEVQAVAETPVQVKLCPICQSYEHLMDECPTIPAIREMFGDQANVVGQFKPNNNAPYG… |
| A0A438J9K2 | 11-134 | MYTLNEDFDMKAEIVAMERRLEELEMWKIQKVHTIFEKPVQAIPCSICLSYEHLVEECPTIPAQASNLEQAIVNLTKVVGDFVAAQK… |
| A0A438FSQ3 | 8-188 | None |
| A0A438FNQ6 | 3-175 | None |
| A0A438FL52 | 6-203 | None |
| A0A438FHZ3 | 182-382 | None |
| A0A438FGG4 | 22-188 | None |
| A0A6P5SY36 | 28-180 | None |
| A0A438FD08 | 9-184 | None |
| A0A438ID50 | 25-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.