DPCstruct | MC56958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 4.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 72.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438JRZ0 | 1-58 | MFKIDAADYMMSICGNDALRELSSPGKSGSVFFLSQDDHFMIKTLRKSEVKLVHKNIF |
| A0A0P0W1W4 | 227-279 | FRNLREMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRK |
| A0A5P1EYF9 | 1-58 | None |
| A0A0A9NT33 | 134-188 | None |
| A0A445AZZ8 | 145-188 | None |
| A0A2P6P892 | 1-58 | None |
| A0A270R7C6 | 50-101 | None |
| A0A0A9KEQ9 | 35-86 | None |
| A0A3Q7I363 | 10-56 | None |
| A0A830BMU2 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.