DPCstruct | MC56956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 183 ± 17 aa |
| Standard deviation of domain lengths | 16.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287HTC5 | 286-453 | SFLSPVQKWVDKKLNDYHLHFSEGSSMMVDIVTVAMLTRRILGEENDKAMESPDRDQIDRYITSSVKSAFMKIAHSIEIKADTSHEH… |
| A0A438JJK7 | 3-167 | FSFQKLDNFKTVMTLALAVGFITSSEGGEIKLTKTNGLDEIAAKKLQTYIQKSIEAAYSRVAATMDLESKLERTHPLALLANELRLI… |
| A0A3L6SBZ5 | 2-146 | None |
| A0A4Y7LEX9 | 69-239 | None |
| A0A7J0FUR1 | 433-603 | None |
| A0A835UGW1 | 434-619 | None |
| A0A2T7CYW2 | 482-658 | None |
| A0A4Y7L413 | 385-603 | None |
| A0A7J7MQV4 | 5-198 | None |
| B7ZXY1 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.