DPCstruct | MC56952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 153 ± 13 aa |
| Standard deviation of domain lengths | 13.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 56.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3QQT6 | 2-124 | NLHFKVKWFHNEYVRELAAFKDTPPEYSLWFEPFVIQWLSENEDVAMDFLHGALGSDKKLGFQPTSEHVLFSCSVVDVFTQLNQSFE… |
| A0A6P4KGL2 | 1-167 | MWHLFAVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHGAFKRDKK… |
| A0A2I0T701 | 196-364 | None |
| F1QVH9 | 928-1088 | None |
| A0A6I9YZV8 | 674-798 | None |
| A0A044S3H3 | 1170-1324 | None |
| A0A3Q0KMC8 | 1646-1788 | None |
| A0A7R9GV33 | 582-744 | None |
| A0A3B3BTE9 | 568-724 | None |
| A0A4Y2DW43 | 28-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.