DPCstruct | MC5695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 436 |
|---|---|
| Mean domain length (aa) | 315 ± 59 aa |
| Standard deviation of domain lengths | 58.93 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 15.25 |
| Pfam Score | 99.56 |
| Assigned Pfam label(s) | CL0194- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M8VUJ1 | 63-431 | ALRPPTRAVKDEATGTWGSGPQPGSLSAPVDPAPPEAPDEHPVVAQLYPRGHRRTPAEMLDEEAYDWIRDPELLTDAECAHTHAVGI… |
| A0A873QIX5 | 29-380 | IPIIKGVPFRDIKQSYTGGSTDAYIPYGENIMCYDINSLYPAAIKKYKYPVGEFISFQNLNNLNINELESILNQNIFGFIDCEVDCP… |
| A0A372QRS2 | 3-279 | None |
| A0A2I1F4H4 | 99-317 | None |
| A0A2I1F7I8 | 6-229 | None |
| A0A2Z6R8Z8 | 2-226 | None |
| A0A327TT42 | 91-470 | None |
| A0A2Z6R4Z3 | 181-505 | None |
| A0A2Z6R5C3 | 2-273 | None |
| A0A372QM35 | 123-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.