DPCstruct | MC56946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 288 ± 38 aa |
| Standard deviation of domain lengths | 37.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M2W1I5 | 22-287 | QFEEYITLQEQTCYDYRHPPDLRCLYIKGQCSVRETPPARLHDRPRDAREEAGAFRLPEIKNITPLLRLQGLACFAHIGYMCWADRS… |
| A0A4S4MVU2 | 19-204 | DSAMAWWMQIAFETSPETNAPIPRGIRVRALSCLANSQWELKVTEDDPDTWNIDSVHRAGVFADDCAALGFVSAIMLHIGMKIRELR… |
| A0A1M2W1F8 | 39-292 | None |
| A0A0C2Y443 | 146-438 | None |
| A0A4Q9MR69 | 127-462 | None |
| A0A4Y9Z5P1 | 7-307 | None |
| A0A1M2VX11 | 3-286 | None |
| A0A1M2W1F1 | 13-280 | None |
| A0A1M2W1H0 | 96-378 | None |
| A0A5C3PI81 | 34-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.