DPCstruct | MC56943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 366 ± 50 aa |
| Standard deviation of domain lengths | 50.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M2VXP7 | 34-393 | VSDVGRKQLLHHIRFSIDYLRRAGLLNAQGQPTNLFGVAAHLYSTEPSNLALVTLLRHGVVHQICSDASADAAKRNLLILLSHIFGR… |
| C3YNI1 | 48-395 | VLRLMLLTARGDDKTDAFNRALNLLKHPFLSHNKPHFQDQLQHHFLFSVQFLMRQGLLDLEGTPQGMAGLASHLHYHEPSNFVLVWL… |
| A0A139XLV6 | 24-495 | None |
| A0A0K0EDA8 | 1298-1683 | None |
| A0A0D2HN43 | 509-848 | None |
| A0A0M8MZY1 | 91-508 | None |
| A0A2N0SKV5 | 317-669 | None |
| X6MH72 | 14-344 | None |
| A0A0N4VAD5 | 216-619 | None |
| A0A2H2IKF8 | 429-803 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.