DPCstruct | MC5694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 14.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A292SVI9 | 23-142 | YDTEKLKQENRYRVKGQAFPKTINGFNWGAFLLTPVWGLFNNTPIACFCIILYLIPYLGILLGIVFSIYCGIQGNVWAWENKEWKDH… |
| A0A292SAL4 | 10-123 | KQTNNSLNQFNWGAFFFIWIWGIFNRVYITLIFIPIVVILSLIGVPDIINSLVSLGLMIWFGIRGNEWAYENKDWSSLEDFHRVQRI… |
| A0A1G1WE30 | 44-178 | None |
| A0A4Q3NIM2 | 6-106 | None |
| A0A1V5WR91 | 107-218 | None |
| A0A1V5WQY7 | 10-103 | None |
| A0A4R1B2F0 | 35-146 | None |
| R7MDI6 | 38-158 | None |
| A0A1M4W7Y9 | 10-121 | None |
| A0A2S6H3W7 | 7-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.