DPCstruct | MC56939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 224 ± 23 aa |
| Standard deviation of domain lengths | 22.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 83.87 |
| Assigned Pfam label(s) | CL0028- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W2ERC1 | 44-262 | LVTTVTLEPAGRCRWDEPVRITVRGLAPGQPVTLRASLRDEKGALFRAHARYCADAAGLLDLERAPALGGSFTGLEPMGLFWAMEPE… |
| A0A2K5LED5 | 2-241 | AATLILEPVGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADARGELDLERAPALGGSFAGLEPMGLLWALEPEK… |
| A0A7R8GZY2 | 227-467 | None |
| A0A7V5R6K3 | 42-282 | None |
| A0A5J5CEI6 | 7-215 | None |
| A0A511D2H4 | 83-306 | None |
| A0A2B4STT8 | 1-251 | None |
| A0A3Q1H5C9 | 1-210 | None |
| K1PMD1 | 312-531 | None |
| A0A1S3J284 | 1-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.