DPCstruct | MC56935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Standard deviation of domain lengths | 19.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3BHK8 | 1-106 | MALILAGDKVLASHMPLYAPPHNYQIVYEVTTDDTHLKTIKNILNKAADEQEQITILPTKFDLNLLINKKTPTLNVTLFNGHFERGG… |
| A0A7W0YBK6 | 1-121 | MRSLAITLALVACGAPQTRRQDAPAVHGMALFGDARTFASHLPMFHAPHDYQVLLQVTLEPHITLAPGELYTIAPTPFELARVETPG… |
| A0A1S8A760 | 35-142 | None |
| A0A1I9Z549 | 1-133 | None |
| A0A7W3R7G4 | 1-148 | None |
| A0A0F0IE73 | 329-417 | None |
| A0A7W9DEW6 | 1-151 | None |
| A0A3M8SZX1 | 297-404 | None |
| A0A010QSQ3 | 180-289 | None |
| A0A2E7GFQ4 | 26-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.