DPCstruct | MC56933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5YBI2 | 9-91 | ADPWTSSKSAFGNAPFDQSFHLILSVAVGSRNGWFLDNLGNKPWIDAAKNAQWTFWNAADQWLPTWAPGPDRGMTVRSVKMWQ |
| A0A2P6N7R2 | 753-830 | DKSFFERGQFPSGTHNPWQGRGNAAPFDQEFYIILNVAVGGAADYFPDDVGGKPWSNKKPAASTVFWQARNQWLPTWK |
| A0A060C7L7 | 1-75 | None |
| A0A6J8ESF9 | 133-207 | None |
| D7FU26 | 60-155 | None |
| A0A6A4H445 | 73-140 | None |
| A0A427YDD4 | 31-123 | None |
| A0A653BJ75 | 76-142 | None |
| A0A7J6JTN6 | 1-75 | None |
| A0A182QPU1 | 158-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.