DPCstruct | MC56932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 159 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5Y9L9 | 1-164 | MPPIKYPDSLLGRLEKSLFDEAQNLLRNMGSRHRSEEYNQLILPRCQKLIQTMGNRMAYEAAKEAKIEPAVLTLFEAGVVAENSAWF… |
| A0A4S4KNQ1 | 122-268 | LPESTHPDSLLARHEKGLLSQGRALLEKMQHHRSDEFNRFILPKCDSIVRAIGHRMAYDAAVDAGLDSTITDLYLVTAVKLDSAWYV… |
| X0J1B8 | 126-299 | None |
| A0A0H2RQ79 | 626-806 | None |
| A0A0F0HXP7 | 1-136 | None |
| A0A2S4KTM4 | 62-222 | None |
| A0A5K1K6B0 | 18-154 | None |
| E9EAM7 | 10-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.