DPCstruct | MC5693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 154 ± 27 aa |
| Standard deviation of domain lengths | 27.04 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401GU93 | 267-468 | RHRLRRSYEKKREWMDERGLCVWNGEWGPVYARREYEGANTEAVNEERYKVLQDQLTIYNQDRLSWSIWLYKDIGFQGMVYVSRETP… |
| A0A0N0V4U6 | 25-170 | IYTSESIAWSIWSYKDVNVMGMTYVSPDSSWLKLLGPMIKKKRDLAVDSWAYDDAHLQDGLFGPLHKWFEDNVPAQYSKKYPWQWRM… |
| A0A2N5KBQ9 | 2-110 | None |
| A0A7X9ZVD0 | 334-487 | None |
| A0A4V1BEJ3 | 21-164 | None |
| A0A524QFX2 | 254-413 | None |
| A0A094F9Z8 | 8-150 | None |
| A0A4Y9ZPW6 | 7-145 | None |
| A0A7C2LJC2 | 68-226 | None |
| A0A135V9T4 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.