DPCstruct | MC56925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 686 ± 70 aa |
| Standard deviation of domain lengths | 70.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0364- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4AK54 | 1-725 | MDSFFEYALKSHILLSEGYPPEFNASGPFHEYDNYFLPLPYQAHSPDSFLKVWEESFEAIKTNLYRGSSYQYPHYIQGDITTGATRA… |
| A0A2C5XF59 | 1-641 | MWIDSLGAFYPGLLALAGEVDEAIEANLVYTALWTRYAALPERWSIRESNVEAGIGWWPGRPEFIESTYHIYRATRDPWYLHVGEMV… |
| A0A5J4NEP8 | 14-701 | None |
| A0A094ZPG7 | 2-745 | None |
| A0A183K1Z5 | 194-935 | None |
| A0A0C3QM37 | 135-706 | None |
| A0A7M3PRM2 | 163-941 | None |
| A0A4T0D2S7 | 2-599 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.