DPCstruct | MC56924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 106 ± 19 aa |
| Standard deviation of domain lengths | 19.33 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5XB55 | 17-121 | AIRGDDPMTMIKKQLIQSVNGHTQLGRDGVVRSFTSKKEIVDYMPFSPGQIRTFIDNHPGIPQNEKENFKASFANVDGYRVSVENMR… |
| A0A194XCN5 | 13-124 | SLKDPQRLAAQKELTQILKPLKHDLTLNGIFALCKDGVFRSLTADRSVVDAVALRPELIKAMLDRMPYKPQNEIDYRGVDGTKVPKE… |
| W7EBV1 | 16-129 | None |
| A0A0F4YLI2 | 80-225 | None |
| A0A5N6FVG4 | 4-97 | None |
| A0A0B8MY23 | 96-229 | None |
| A0A3M6W4B5 | 86-218 | None |
| A0A1B7P8C8 | 13-126 | None |
| A6R258 | 3-91 | None |
| B6QAL9 | 8-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.