DPCstruct | MC56917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165HR04 | 1-86 | MSARRSGLQKEVLSLYRRALRMANSKPPAARPKFMLFVRYTFRTQAAAISSRDVSAIEHLLRRGKRQVEVYEDSKVCDCWVSAEML |
| A0A6J1I7F5 | 28-124 | RSSMGVSSAPKLSGMQMQVLSLYRAFLRAARSKSAEDRKGIESVVSAEFRRNAKLIDHKNFIYIEYLLRRGDKQLDQLRSPATVGLS… |
| T1FYS3 | 1-81 | None |
| A0A443NC71 | 3-85 | None |
| K0TG69 | 2-87 | None |
| A0A507F514 | 1-117 | None |
| A0A1J6IHB7 | 1-76 | None |
| J4U6E5 | 24-120 | None |
| A0A1D1W9Z8 | 9-95 | None |
| A0A0F7SRT5 | 25-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.