DPCstruct | MC56908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 266 ± 69 aa |
| Standard deviation of domain lengths | 68.62 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812JZG7 | 2-250 | AYALFLHGSAVQEISLEYGPDDLWKEIVVEEGLAGASLISYELLSFSANNRHYLESRPLAFNLLVAQYSCTGITQVADVLPRRSPDP… |
| A0A1X0S2Y2 | 1-188 | MKGPVYMYYRLTNFYQNHRQYIKNFDSSQLLGDVVPSTTLHTDCDPLAYSNGKVIYPCGLIANSMFNDTVSNFTSIDHPSLTYSFSS… |
| A0A3Q0JAK0 | 12-211 | None |
| A0A5P1F104 | 345-620 | None |
| A0A7S3JE57 | 6-160 | None |
| L5KAI3 | 74-242 | None |
| A0A1V9YZG8 | 362-803 | None |
| A0A445IYT8 | 260-567 | None |
| A0A1I8F715 | 92-285 | None |
| A0A443P1K5 | 29-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.