DPCstruct | MC56907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 509 ± 79 aa |
| Standard deviation of domain lengths | 78.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812I355 | 165-723 | EHEAEDPPQPERPEPNNRAEFKLLRESFEGTDEMIEEFLHDHEHHLRTRILIYGGSVLHQEYANWLEKQKGDAFDKLHFQAARSLGS… |
| A0A812JHB3 | 82-530 | CLALATGARVQHLVRETITSATSWATLEAINASNPSLDAGAQETMQMHVTLTCSWLGSMYELSDHFKCFPWKSILACHERRFVQLLE… |
| A0A812IA66 | 697-1246 | None |
| A0A812UCM3 | 177-743 | None |
| A0A2D5E161 | 26-484 | None |
| A0A1Q9DSQ7 | 156-788 | None |
| A0A812Z3P8 | 36-456 | None |
| A0A1Q9C975 | 275-726 | None |
| A0A1Q9CHJ4 | 5-467 | None |
| A0A812KBZ6 | 8-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.