DPCstruct | MC5690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8RDP4 | 23-109 | ISAVLIFGDVRHTANQAYNYLSGAGASGLFPRPADQLAGMARYADVLRSYCVDSDPICAGGDTSANHLNYFDIYSTDAGKWVQELVG |
| A0A0M9EP89 | 1-83 | MVFGDTRHTADQPYNVLSGVCKNGLFPRPADQLGNLASYGDVFQAYCVATDPICAQGKDVETHLNNFDVFTDEAADWVKERVE |
| A0A395MN08 | 150-235 | None |
| A0A4Z1KUK0 | 9-103 | None |
| A0A364N4E5 | 139-232 | None |
| A0A2U3E4U0 | 154-238 | None |
| A0A4Z1PBF7 | 150-243 | None |
| A0A5Q3FUS8 | 1006-1085 | None |
| A0A3M9XY38 | 76-163 | None |
| A0A2P2H4H8 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.