DPCstruct | MC569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 47 ± 4 aa |
| Standard deviation of domain lengths | 4.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4I776 | 4-50 | KRVNNKSLFLCEMCGLGYLEKETAEKCEEWCKKTGTCSIEITKKAVY |
| A0A1N5WEV7 | 1-48 | MVKLDENLFQCEICKLHYENKTDAGKCQEWCSQHNSCNLEITFRSIEA |
| A0A0G1WT27 | 2-48 | None |
| A0A081RL74 | 16-61 | None |
| A0A6N0NS17 | 3-50 | None |
| A0A1F7QMM7 | 62-104 | None |
| A0A2M6WVT6 | 81-125 | None |
| A0A1F3BIS9 | 1-52 | None |
| A0A7L9FGU4 | 2-50 | None |
| A0A1G2RSN0 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.