DPCstruct | MC56898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 142 ± 16 aa |
| Standard deviation of domain lengths | 16.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20282 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2R9P0 | 5-142 | PPQEVAATESRYVTQLFGAYSEHTGTIVTDPSALPLPKLKDHFRRQREAFYEAESLRVFARDSVPPGTFEALLDDIHDGVIDTHDGN… |
| A0A1Y4NBR3 | 86-234 | QLIPQSALKTGELPYINALCEVYAEKINNIVTADTINSLPSRYRKDFANQRMAYYSAESVQRSVREVFADGEQQFKALKQDAFDGIS… |
| A0A4S2S3L6 | 183-334 | None |
| A0A316H6V0 | 323-474 | None |
| A0A0Q0CBK7 | 41-188 | None |
| A0A2G3E724 | 180-334 | None |
| A0A0J8ST74 | 3-99 | None |
| A0A2R7RLR1 | 37-182 | None |
| F9H946 | 39-191 | None |
| A0A645GEG6 | 93-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.