DPCstruct | MC56883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 180 ± 37 aa |
| Standard deviation of domain lengths | 36.57 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.45 |
| Pfam Score | 98.21 |
| Assigned Pfam label(s) | PF08312- CL0105- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6TZU9 | 1-185 | MSSNVGLSTPRGSGTSGYVQRNLSHLKPRDPRPTHNPAEYASHIPRAPDPAILEHERKRKIEVSCLELRDELEEEGKLDEDAIDEKV… |
| A0A5P2UDW0 | 1-120 | MSYNGIGLSSAKGSSTSGYVQQSLAFTNRKKDPRSTTHDKEQQQQQQQQQQQQQQQQQQQQQQIQLAKDESVISHKAKRQIELLVSE… |
| A0A0F7SHX2 | 1-230 | None |
| J5RZD2 | 1-133 | None |
| A0A086JWU9 | 1-235 | None |
| A0A1D2N635 | 1-150 | None |
| A0A0K0E8D7 | 1-218 | None |
| A0A1V6PN76 | 1-159 | None |
| G4TCT1 | 3-199 | None |
| A0A1E3ITD8 | 2-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.