DPCstruct | MC5688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 79 ± 2 aa |
| Standard deviation of domain lengths | 2.41 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06793 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1Z0W2 | 1-80 | FMLSLTPFRRILRDYFVICESYYEAIKTAPPSRIEAIDMGRRGLHDEGSRVLQERLAGKAAMDFKTARRLFTLICALHRR |
| A0A178XX01 | 60-137 | LSLTSFRRLLKDYTLVCESFTNGAARLPPDRLEAIDMGRRAIHNEASALLRERLKSKVEIDEETARRLFTLIHLLVSQ |
| K2GQQ1 | 75-154 | None |
| A0A1J5NWD4 | 33-110 | None |
| A0A5R9J3S6 | 102-176 | None |
| A0A6L7XFG3 | 94-169 | None |
| X6JJJ8 | 3-82 | None |
| A0A4S5IZC4 | 75-157 | None |
| A0A2A4YW22 | 46-127 | None |
| A0A6A5LAK2 | 608-688 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.