DPCstruct | MC56879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 253 ± 36 aa |
| Standard deviation of domain lengths | 35.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3MI14 | 31-292 | AFISHLDKHKKMTKFIVFLPVLAINTALATLLIYRFLSGSSVDLIVGIFLGKYIAPSYSTSKSLKSWIWVTLCGLFDYYLFKNAMPP… |
| A0A0C3HCX9 | 4-239 | EDSSREILNRTTTFMTDLLLYIFVWPWPRDFFSGRRVGNPLFWRIGVGFRDQEIVIRRSRRWDLKIGNFLNEHNEGRQLFFDNVKTA… |
| F0XEH5 | 96-415 | None |
| A0A5M3M7B5 | 203-422 | None |
| A0A0C9Y322 | 37-257 | None |
| A0A6A6TV21 | 87-358 | None |
| F8NK25 | 68-312 | None |
| A0A5N6KT75 | 3-284 | None |
| A0A194V2U7 | 87-380 | None |
| A0A7R7X032 | 203-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.