DPCstruct | MC56875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 139 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9NDV3 | 1-149 | MNLMSLHCYKEAAVLSVKLKLQKDLNMEEMCVPLILQNKLPLAESFVTGHYHLEQQLVTLLDSWCHAYFSVDEISRRYPRLSLTKHC… |
| A0A7R9QE84 | 133-272 | LLADNKFFEASLLVIKCELRDHFDIKDLLVPLLLQDKLTVVDDYIRGHEKTHGFEFIKFLDKCFADRSVGDPFADRIPGARRDKLEP… |
| A0A131YCD2 | 127-268 | None |
| V4ALW2 | 24-166 | None |
| J9BG93 | 1-131 | None |
| A0A2P8ZCL6 | 105-233 | None |
| A0A183E1Q3 | 1-127 | None |
| A0A183EL05 | 1-144 | None |
| A0A060Z2Y3 | 138-275 | None |
| A0A4V6A619 | 230-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.