DPCstruct | MC56870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 192 ± 21 aa |
| Standard deviation of domain lengths | 21.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9N6Z9 | 10-189 | FQVCDVDFKDLKACVRLVLPLQCDTRGCDLTEEAMKVLLGASGDKVPLQQLQVVYELSGDFDQTALAVEHLRFFYEHIWRQWDEEDE… |
| A0A3B4G4C7 | 107-294 | TDIFDVLVEVRDVEVKDLKARVRLVLPLQCDTRGVELHEEAMTSLLEATQHKVPLQELQVVYEESGDIDQTALALEHVRFFYKHIWR… |
| A0A444UC90 | 1-165 | None |
| A0A674JJM6 | 138-306 | None |
| A0A2J8N6M2 | 141-309 | None |
| A0A1S3IF38 | 550-731 | None |
| A0A7M7N6X4 | 166-406 | None |
| A0A7T8QWN6 | 12-175 | None |
| A0A6J1QCQ1 | 55-271 | None |
| A0A6B0REG8 | 107-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.