DPCstruct | MC5687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 10 aa |
| Standard deviation of domain lengths | 10.26 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W2C7C8 | 6-69 | TVAALPAGGSDAVAADCRAAAARVVAEVGGQLLSVRESGGECVIVVLVPGSGSERPRKVTMRVA |
| I3X0D3 | 2-53 | AGDCSAAAAQVVAETGGELLSAQPTADGKCVVTVLIPGNGGRPKKVTVKVPM |
| A0A7W6XPD0 | 120-201 | None |
| A0A395LG73 | 3-60 | None |
| A0A387G872 | 31-102 | None |
| A0A285XNU9 | 31-105 | None |
| A0A1C3VEQ1 | 7-63 | None |
| A0A7Z8LGW6 | 21-103 | None |
| F0L8K9 | 90-153 | None |
| A0A8A3KI59 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.