DPCstruct | MC56862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 113 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.72 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0001- PF11598 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9MY75 | 25-127 | FQQKDSVQTLGVNTKQLSNQMLDLTKVINELKDVLIQQVKETSFLRNTISECQACGLGGTEVVKPRCGPGVCFRDVRCIETADGVEC… |
| H3DRE7 | 1-113 | VNGDVGSLLGGDHTKALIGQLIIFNQILGELRLDIREQVKEMALIRNSILECQVCGFHEPRSRCSPNPCYKGVACLESLQYPGFTCG… |
| A0A2P8XU31 | 193-305 | None |
| A0A6G0U9V0 | 175-280 | None |
| A0A811VCR3 | 1-119 | None |
| A0A834FHT9 | 12-121 | None |
| A0A1Y1KJU8 | 60-171 | None |
| A0A139WDZ8 | 209-321 | None |
| A0A1Y1KC81 | 62-171 | None |
| A0A1Y1KEV5 | 223-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.