DPCstruct | MC56861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 157 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9MUG1 | 5-157 | SALLLSLVEEYVSGLQDSKAKDTATAVKNGEFTVLQLVEALGLSLTSSQPHTRARGVQLLSEVLHECYGGLTEKEVEVLLVFYENRL… |
| A0A0N4YQ82 | 2-142 | AASEAARSLYREIVVDKSLSLSDFFEKKRPLLLSQSDDEKEAAFSELIELLSLFPDDFLPEQQVGLLLDFFLGIFESSPITASFAVP… |
| F8WCH8 | 1-173 | None |
| A0A0N1P1R8 | 2-154 | None |
| A0A6A4WPE6 | 8-170 | None |
| K1RGI6 | 3-157 | None |
| A0A0C4EUI0 | 5-181 | None |
| A0A4D9B3U9 | 7-181 | None |
| A0A2T9XYK0 | 2-155 | None |
| A0A182NSN4 | 307-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.