DPCstruct | MC56860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 621 ± 112 aa |
| Standard deviation of domain lengths | 112.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 87.31 |
| Assigned Pfam label(s) | CL0023- PF12777- CL0671- PF18199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9MMH5 | 65-663 | HVLERIQPLEREQAGLLENMRKTESRKNKLENQLNSVGAKVNELKEKFQCHTTEAAKLEAEVTKAQDTITAAQQLLSQLEGEHTRWN… |
| A0A822BEF2 | 2-562 | RVDLQPLSIMIDDADIAEWMNQGLPADQTSYENAAILIYCLRWPLMVDPQGQGLRWIKNLFTDKLVTLRYNSKGYLDRVEAAVRRGD… |
| A0A2P8YMB4 | 415-1207 | None |
| A0A2K1INX7 | 515-1006 | None |
| W2P9Z5 | 165-849 | None |
| A0A0D8XQC7 | 331-926 | None |
| A0A822DYW5 | 121-767 | None |
| E7FFM4 | 1469-2142 | None |
| A0A2V2VUL2 | 2-584 | None |
| A0A3Q0IRD1 | 255-863 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.