DPCstruct | MC5686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A099D2N8 | 3-113 | LLQHDAAGNWFTPEWLSRGTGKLPVPREETPADDLAQVMASCSLRLPLAFSNAEAEEELWQATPKSWEKSPHIYSMPVLLIGQDGWG… |
| A0A0S1UY16 | 5-112 | VRDGEMGEEVVLVVREREGEVVRTLSGRALSVNGDVADELIDDVLAGTVRLPGGPASSAAAALGPLPGWVGHPRLRYARALVLDGSG… |
| W7IVS6 | 920-1036 | None |
| A0A426Q5J2 | 342-450 | None |
| A0A7Z0J8Y9 | 5-124 | None |
| W1V8D7 | 79-208 | None |
| A0A0F0HK85 | 95-206 | None |
| A0A1G7Z0J8 | 315-425 | None |
| A0A1C4JN46 | 842-952 | None |
| A0A2G6XUT0 | 164-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.