DPCstruct | MC56859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7MFX2 | 1-112 | MVQRIAGKSMPIEKFAMKKSKRYFEQGKRLTLPGMELMYLWNGFKLVFTKKDILEKFLLLVEFKLNRLLAEEANYKYFPDDFCLATM… |
| A0A2D4G3R4 | 58-173 | FRQVEGLKQRIAGKSIPTEKFAVRKARRYGTSPPVKLIVPALEMMYIWSGFSVLGKRADFTENMLITIEKEETLLKNETHHNEYYMD… |
| A0A7R9DSY4 | 2-100 | None |
| A0A0B1T3T4 | 15-118 | None |
| A0A6H5IP50 | 311-426 | None |
| A0A0B2USJ9 | 166-277 | None |
| A0A7R9KMB3 | 190-301 | None |
| A0A7J7KH27 | 152-268 | None |
| A0A2H2JLS9 | 121-231 | None |
| A0A4Y2DRP0 | 70-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.