DPCstruct | MC56851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 170 ± 36 aa |
| Standard deviation of domain lengths | 35.89 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533YYR0 | 2-169 | TRKPKAIVIMAIVAAALALGGVAVPLTSHPRFCASCHNIKPSYDSWVVSTHKDVTCVDCHVRPTLEGYLNDKVKAGLKDVAISVFST… |
| A0A1E5G2W8 | 6-143 | SANKWAVMFFVLIALVVVYSGTAISMKATDSAEFCSSCHVMNEVVRTHQVSTHANLSCNDCHAPHNITSKIPFKMKAGAKDIYINTF… |
| A0A7X7R922 | 2-150 | None |
| A0A7C1LU44 | 163-422 | None |
| A0A7C3GPG2 | 1-129 | None |
| E1WKK0 | 3-128 | None |
| A0A0F7K0F3 | 25-197 | None |
| A0A285NNX7 | 14-194 | None |
| A0A7Y2HV11 | 14-196 | None |
| A0A450S7N8 | 60-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.