DPCstruct | MC5685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 170 ± 22 aa |
| Standard deviation of domain lengths | 22.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L2MPA1 | 1-183 | MSEQTPEPTFRDSVTRLAALGALFDEVKAAYRKARTEVQHHLNTQYKEAGTTKVDALLPGGTKVGSVSRTGGETAAQIVDPDTFTAW… |
| A0A0S1UI40 | 13-200 | AQDAEQPVESLRDLAVEEAALDLLAARVAAAKKNVRARMQTALDRAAKRDGVERVAAELPNGQTVATISLRRGTTGPVVTDPEAFAR… |
| A0A4P6Q7U6 | 4-186 | None |
| A0A7T0KHM9 | 4-164 | None |
| A0A418L195 | 103-284 | None |
| A0A7H8ZST2 | 52-233 | None |
| A0A0H4BYZ7 | 14-186 | None |
| A0A851HJA2 | 10-220 | None |
| A0A4Y9F1X5 | 1-132 | None |
| A0A6H9YVV2 | 4-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.