DPCstruct | MC56844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 161 |
|---|---|
| Mean domain length (aa) | 177 ± 35 aa |
| Standard deviation of domain lengths | 35.42 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01558 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8HDW6 | 7-144 | EVIASETHGMAMRGGSVISTLKVGAYRGPLIGSGQADVMLVLDPGSYDTFANLLSPKGISFVNTASPVSYPHIDATDLAAKMGSPLM… |
| A0A832RZ40 | 3-107 | QAYEKYLPLVKKGGIVILEKELVPNRNEELEKNFKVFAIPLTKVAEETTGLSLTMNILTLGVLVKLTSVVSEESIEKAVLDSVPKGT… |
| E4THY2 | 1-132 | None |
| A0A2N6T1F6 | 2-197 | None |
| N0BJM5 | 2-149 | None |
| S9QUN2 | 16-149 | None |
| A0A2R7RWG6 | 314-525 | None |
| A0A1F8LJV1 | 4-178 | None |
| A0A812IL12 | 4-177 | None |
| A0A832UAN0 | 4-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.