DPCstruct | MC56842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 212 ± 32 aa |
| Standard deviation of domain lengths | 31.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6AXG4 | 27-250 | RRWEEALREQEQLTIEYDRFQTSTPAKLSDNERQEIKSLSECLPQLWIAETTTAEDRCEIARLLIDEVVINVEGDSERVDVDIHWKG… |
| A0A3S1AL48 | 16-216 | KVSLLPKELKAAFTAIGQTLPQLWHSGVLTQVQKKSLLRCLIDKVVIHRVVRDQVRTRIVWKGGDTTTIDLPIPVGSLAELTNSHEL… |
| A0A7C3AMD9 | 4-169 | None |
| A0A1M3H5P0 | 46-285 | None |
| A0A2V9LLX8 | 4-176 | None |
| A0A143PIZ1 | 326-561 | None |
| A0A1Q6Z7B6 | 35-224 | None |
| A0A1V1P201 | 82-353 | None |
| A0A7X0GV32 | 5-172 | None |
| A0A433V5Q5 | 18-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.