DPCstruct | MC5683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 159 ± 22 aa |
| Standard deviation of domain lengths | 22.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06353 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2NBN2 | 5-176 | VVWRVEALAAPPLVAPCARCDGVARFDCTHRFRVNAQQHRLDVWLLYRCAGCGDTRKRRLLHRRAVASLAPGLLDGYHRNDPALAWR… |
| A0A0K9NBJ1 | 39-200 | REYRCSGQFRVNAQRKHLDIWLIYRCPHCDATWNLPICSRISSAGIDSDLLERYHNNDWKLAAQHALNMGLLRQNGAIPCTPAFTAA… |
| A0A1M7Y7V3 | 29-182 | None |
| A0A829XJA4 | 1-137 | None |
| A0A2V3YET3 | 11-217 | None |
| A0A7W6U606 | 5-163 | None |
| A0A845J4M5 | 3-198 | None |
| A0A7Y0Q4F6 | 1-146 | None |
| A0A720GJ64 | 3-162 | None |
| A0A412UUA5 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.