DPCstruct | MC56829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 295 ± 43 aa |
| Standard deviation of domain lengths | 42.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7V2L1 | 78-335 | GNLVPSYFSTLSENETFAISEAEALQEYFSNTEFRTVVNSGLYLYVPESGCFCLNSRKFLYFDHEGHPHLRKYAREHMAQCCLVFRA… |
| A0A380KCF5 | 22-286 | IDYEEALYEQYKKNDYKQIDVVLTKEEFKDKKVVTKVPTEKLSSWYQESGAVASIIETDAFAYIEERLCLNTSDYVERKSSGGLGLT… |
| A0A1Z2XRQ9 | 415-780 | None |
| A0A3S9QMX8 | 2-248 | None |
| A0A1V5GIA4 | 466-786 | None |
| A0A373C5W0 | 228-489 | None |
| A0A6N2VI00 | 39-321 | None |
| A0A413W2X2 | 693-1055 | None |
| A0A227L6U9 | 115-449 | None |
| E2ZD34 | 3-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.