DPCstruct | MC56824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 168 |
|---|---|
| Mean domain length (aa) | 96 ± 16 aa |
| Standard deviation of domain lengths | 16.15 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 95.24 |
| Assigned Pfam label(s) | PF02586- PF16200- PF04222- CL0106- PF06961 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4YTV5 | 2-83 | NKADLINDLAKILPTKKEAEQTVNVIFNSIKESLRSYNKVTIANFGSFYVKSYSPRKVHRLKDGAKILIPPRKIVKFKPSKK |
| A0A3R6B0U8 | 20-111 | GMIYGRAVVNKVVHTRAIAKKITERCTVTEPDILAVINALMTEISANIADGNKVVLDDFGSFKLGIRTTPAESARKFTEANIKNKYI… |
| A0A1G3MHQ0 | 188-288 | None |
| A0A3S5XZI0 | 185-285 | None |
| D6BE89 | 14-108 | None |
| A0A559SQ19 | 71-167 | None |
| A0A1M7HPZ8 | 1-95 | None |
| A0A858ARV1 | 142-236 | None |
| A0A822MV69 | 74-166 | None |
| A0A1G3L7H3 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.