DPCstruct | MC5682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Standard deviation of domain lengths | 10.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9Z5J7 | 2-70 | KDKLLVIELDEYGSVPRVFYKGEEIKGKVRVLFDWHTKDDKHFGLPNIEIEYGDYENGSPVCKAIKLSN |
| A0A317KXU0 | 93-177 | VDALTYAYEHMTDYKNKSLLTIELDDIDSVPKVFYKGEKIEKKVHVSFDYKTKTGNPFEGGNEIHIEHFTGKRPDTRTIKHNNKR |
| A0A2T0F5M4 | 26-112 | None |
| I2C879 | 68-145 | None |
| A0A2C8EGY1 | 122-212 | None |
| V7ZM33 | 5-92 | None |
| U2Q6V2 | 28-147 | None |
| C2Z7A0 | 2-75 | None |
| A0A2K3YNM5 | 1-97 | None |
| A0A7T9W5Q0 | 91-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.