DPCstruct | MC56817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 390 ± 55 aa |
| Standard deviation of domain lengths | 55.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0126- CL0598- CL0159- PF03272 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7UXT0 | 76-502 | WLFNYGKKEAVEKNLYTKLVKQDGTYGSVDLREKLILLTMLKQKAGNEAFTKMYQGYRELANQNGFSKTDYPLPDLLNRYYSETSKQ… |
| A0A151URA7 | 65-379 | EKMNEFEKLVMFWQLHLAYGDQFYPKLHQMYRLLHNTELPKSDEEKKQMFIYMTSKVAGQNLVPFFEKWGLSANDDTREKIEKLNLP… |
| V7HSW9 | 49-446 | None |
| A0A2L1U3E7 | 714-1218 | None |
| A0A0Q5MNZ8 | 310-647 | None |
| A0A4R0XUH5 | 323-760 | None |
| A0A2W1PP49 | 520-899 | None |
| A0A366UIC3 | 343-669 | None |
| A0A4V6RDB1 | 712-1099 | None |
| A0A1E5MKM2 | 656-1029 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.