DPCstruct | MC56814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 50.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3HG37 | 1-91 | MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYRIQRRTLFKEDFINYVQYEINLLELIQRRRTRIGYSFKKDEIENS… |
| A0A6A0ADQ9 | 1-79 | MADTVRYLMEEMIPELEELESKGYFNRGEIKSIVQKRQDFEYALKRRAALKRDFLRYIEYEQKLDELRLHRKKELGIKG |
| A0A397J4P0 | 1-98 | None |
| B5XAY9 | 1-99 | None |
| A0A830BR05 | 1-84 | None |
| A0A197K993 | 1-73 | None |
| A0A7R8ZW38 | 647-723 | None |
| A0A6P6EUD6 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.