DPCstruct | MC5681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 167 ± 16 aa |
| Standard deviation of domain lengths | 16.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538KRB2 | 2-157 | SDAADELYGLPLEEFVPARDALVRELRAAGRRDEGKAVAALRKPSVAAWAANQAVRSQPKAARELWAAGDGLLAAHQDVIARRAGGD… |
| A0A2T0SXA2 | 19-172 | VDQAADELYSLPPADFVTARTKRVTAAPDKDTARAIAALRRPTVAAWAVNRLVRDGHALVDEAFDLGSRLRSAQRRMHGSELRRLDV… |
| A0A534NRG3 | 254-416 | None |
| A0A7W1LRF3 | 4-185 | None |
| A0A8A6HXU2 | 4-174 | None |
| A0A840NN18 | 8-177 | None |
| A0A542EBQ8 | 7-187 | None |
| A0A7W0JKM3 | 2-152 | None |
| A0A4R0KYD4 | 4-144 | None |
| A0A2V7WAZ1 | 5-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.