DPCstruct | MC56803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 171 ± 59 aa |
| Standard deviation of domain lengths | 58.53 |
| Length coefficient of variation | 0.34 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H5TA31 | 17-194 | VSYDSLLLVYDAQDIRYDIVLRFLLSTLAELKEPEKKKSHAKKTEKEIGHVHQIDVCYELNNKSQPSDMSAVEEYTNLTSRDIVSLH… |
| A0A838S8M9 | 1-121 | LPVRYDGPDLELVAETAGCSIDDVIALHSQSAYTVAFNGFAPGFGYLTGLAPELQQPRLERPRERVPAGAVGIAGEFTGAYPRPSPG… |
| A0A847A832 | 2-128 | None |
| A0A6N3UAG1 | 37-196 | None |
| A0A7C1BLM7 | 161-270 | None |
| A0A2X3J8H5 | 20-177 | None |
| A0A2A2AMZ3 | 18-220 | None |
| A0A6N8FBN6 | 338-506 | None |
| A0A7C6N5M1 | 759-873 | None |
| A0A6I7QTS0 | 338-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.