DPCstruct | MC568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 124 ± 21 aa |
| Standard deviation of domain lengths | 21.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4GS50 | 3-122 | SKNKISEKSILRNGNSQNLNFHIIDGTKYSIANTCAFDSFSQVMMKLIRIEWVRDSIVHWESLYSKFLIRLSSKGITSNTYAERATV… |
| A0A026W937 | 311-420 | VMKNGNLCQPVKLQGKTIMIRNTCAFDALLHISAHMIGVDAQYKQVIHDTDDRLMQLASKIVSGGKITKNEYTERAYILTNLSLFQE… |
| A0A6G0XZH1 | 325-526 | None |
| E2BYD7 | 215-340 | None |
| D6W830 | 98-206 | None |
| J9MAU8 | 900-1027 | None |
| A0A2S2NH91 | 631-751 | None |
| X1WZY9 | 460-570 | None |
| X1WSX2 | 81-184 | None |
| A0A6G0XZS1 | 99-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.