DPCstruct | MC56797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 16 aa |
| Standard deviation of domain lengths | 16.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6TWX2 | 1-146 | MDGITIRNVDILRQHEAQQLYQGSLAINVGDENLVQNVLIDGFRVEDIAIGQLINMRVMYNTKYNTAPGRGIRNVTIKNMSYNGTSA… |
| A0A6N2X6S8 | 1-107 | MAIDAGDRNRVKNILFEDIRVESIQEGKLFHINIRFNPKYDKQPGQSIDGVTFRNITYNGVGENPSLIKGLDKERMVRNITFENVVV… |
| N4V1T3 | 300-466 | None |
| A0A7X6TF79 | 626-767 | None |
| F9D4T0 | 704-853 | None |
| A0A173RXK3 | 334-473 | None |
| A0A4V5N3F4 | 1044-1188 | None |
| A0A4Q4UZR1 | 139-282 | None |
| A0A6A6R534 | 919-1063 | None |
| A0A1I2GV12 | 72-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.