DPCstruct | MC56796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 179 ± 34 aa |
| Standard deviation of domain lengths | 34.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0713- CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6TWT0 | 23-175 | SMDLPLYFLRHNLRLPFTSLDTLRRTNGGQIGSARLLDPNDPSSDFRCSITLIDVASNRFCFNDSYHTSHHLHARRHWREHPVALLR… |
| A0A7S0ZK27 | 122-278 | AFQMVRGMCVYYAVGCVLLLKDWRFGVGYYVVPFLETMVYLSAMNYAWHAFADENDSENEYIKSLTILNGQYPVLNEDYHVVHHLKP… |
| K8F131 | 404-605 | None |
| A0A1Q9CGC1 | 28-233 | None |
| A0A2H4S8A2 | 666-827 | None |
| A0A7S4NN08 | 31-215 | None |
| A0A7J7QME1 | 792-1095 | None |
| D2VCD4 | 299-452 | None |
| A0A7S2MJ61 | 14-255 | None |
| A0A0L0TF67 | 4-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.