DPCstruct | MC56792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 332 ± 41 aa |
| Standard deviation of domain lengths | 40.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6T1L6 | 1-285 | MWTPRAACKKAKSDASALNTLGDELEEPPKVIVTESVLTALRRCTCHLITILVTITIITLNLKGAYLGADLMSPVRSETINLMFLQL… |
| B2WIC9 | 1-293 | MANEPVENPFLRPSLDGRASISATSKLASIYSTLLSGLFFVVALLQPKYGHIVSARGRFSPSSAALLTAFIAKTVELTFVMVSLAFI… |
| A0A7R7WH65 | 2-321 | None |
| A0A1L7WS60 | 1-315 | None |
| A0A094AA05 | 47-435 | None |
| Q2H7N1 | 13-364 | None |
| A0A3N4KAB6 | 6-281 | None |
| A0A6A5YWX7 | 1-323 | None |
| A0A178FI80 | 429-741 | None |
| A0A420RJN0 | 1-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.