DPCstruct | MC5679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 177 ± 17 aa |
| Standard deviation of domain lengths | 16.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218Q7Z5 | 54-211 | RRQERILNIIFKSKEKPPWKVRGENPTRASYHIPNCKKRLTWEQIRKAAAPFTWGEYRATATMSSGRQMAVYGSTKEEAVKVVRSLA… |
| T2IZB9 | 1-163 | MQRVTITIPGIKKSRLDWQRIKETAGGNTGYMWGRFSAVAKLKNDQDEFTGQMQVYGGSESEAERRLKACLELSDYSIQTLTITEER… |
| A0A845YQQ9 | 1-182 | None |
| A0A6P0RDM8 | 20-162 | None |
| A0A2G7GP03 | 141-329 | None |
| A0A7C9TW18 | 210-411 | None |
| A0A1Z4R893 | 50-237 | None |
| A0A7Z9E082 | 223-410 | None |
| A0A1Y0RKL6 | 560-738 | None |
| K9TCA8 | 181-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.